Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-26 (HV226), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 2-26 (HV226), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-26 IGHV2-26

UniProt

A0A0B4J1V2

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNA wybutosine-synthesizing protein 2 homolog (TRMT12) Mouse ELISA Kit
H9010 96 Tests

TRNA wybutosine-synthesizing protein 2 homolog (TRMT12) Mouse ELISA Kit

Sign In for Pricing
View Details
SolA Antibody
orb821764 2 mg

SolA Antibody

Sign In for Pricing
View Details
Anti-Tiragolumab Neutralizing Recombinant Antibody (SAA2973)
AS739033-01 50 µg

Anti-Tiragolumab Neutralizing Recombinant Antibody (SAA2973)

Sign In for Pricing
View Details
Anti-Tiragolumab Neutralizing Recombinant Antibody (SAA2973)
AS739033-02 100 µg

Anti-Tiragolumab Neutralizing Recombinant Antibody (SAA2973)

Sign In for Pricing
View Details
SANITAIRWARMWATER150X12CARD-T1-P16 Pipe Markers for Water
N006256 5 Card (5 Marker (s) x 1 Card)

SANITAIRWARMWATER150X12CARD-T1-P16 Pipe Markers for Water

Sign In for Pricing
View Details
Acoxl sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
11198116 3x 1.0 µg

Acoxl sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details