Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-73 (HV373), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-73 (HV373), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-73 IGHV3-73

UniProt

A0A0B4J1V6

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLKLSCAASGFTFSGSAMHWVRQASGKGLEWVGRIRSKANSYATAYAASVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Myometrium
CS700486 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
Vitamin C (VC) Colorimetric Assay Kit
E-BC-K034-S-01 50 Assays (48 samples)

Vitamin C (VC) Colorimetric Assay Kit

Sign In for Pricing
View Details
Vitamin C (VC) Colorimetric Assay Kit
E-BC-K034-S-02 100 Assays (96 samples)

Vitamin C (VC) Colorimetric Assay Kit

Sign In for Pricing
View Details
CD79a (JCB117 + HM47/A9), CF647 conjugate, 0.1mg/mL
BNC470828-100 1x 100 µL

CD79a (JCB117 + HM47/A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pyriproxyfen-D4
TRC-P998852-1MG 1 mg

Pyriproxyfen-D4

Sign In for Pricing
View Details
Ccnj Mouse Gene Knockout Kit (CRISPR)
KN502820 1 Kit

Ccnj Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details