Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-73 (HV373), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-73 (HV373), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-73 IGHV3-73

UniProt

A0A0B4J1V6

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLKLSCAASGFTFSGSAMHWVRQASGKGLEWVGRIRSKANSYATAYAASVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Liver
CS702889 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
ROCK2 Rabbit Polyclonal Antibody
ER1706-48 100 µL

ROCK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MFluor™ Violet 450 Azide
1690-AAT 1 mg

MFluor™ Violet 450 Azide

Sign In for Pricing
View Details
Human FAM243B activation kit by CRISPRa
GA119533 1 Kit

Human FAM243B activation kit by CRISPRa

Sign In for Pricing
View Details
(±)-Perillaldehyde
TRC-P229700-500MG 500 mg

(±)-Perillaldehyde

Sign In for Pricing
View Details
PI 3 Kinase p85 beta (PIK3R2) (N-term) Rabbit Polyclonal Antibody
AP14949PU-N 400 µL

PI 3 Kinase p85 beta (PIK3R2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details