Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-73 (HV373), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-73 (HV373), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-73 IGHV3-73

UniProt

A0A0B4J1V6

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLKLSCAASGFTFSGSAMHWVRQASGKGLEWVGRIRSKANSYATAYAASVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endothelin 1, Succinyl-[Glu9, Ala11,15] (8-21)
MBS659185-01 1 mg

Endothelin 1, Succinyl-[Glu9, Ala11,15] (8-21)

Sign In for Pricing
View Details
Endothelin 1, Succinyl-[Glu9, Ala11,15] (8-21)
MBS659185-02 5x 1 mg

Endothelin 1, Succinyl-[Glu9, Ala11,15] (8-21)

Sign In for Pricing
View Details
CD40
552769 100 µL

CD40

Sign In for Pricing
View Details
50ml, transparent, bulk
JYC-50-T 5 pcs/bag, 45 bags/ctn

50ml, transparent, bulk

Sign In for Pricing
View Details
Lentiviral mouse F2rl2 shRNA (UAS) - Lentiviral mouse F2rl2 shRNA (UAS, GFP) (100)
GTR15216825 1 Vial

Lentiviral mouse F2rl2 shRNA (UAS) - Lentiviral mouse F2rl2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Pyridoxal 5'-?phosphate (monohydrate) (Standard)
HY-W011727AR-01 5 mg

Pyridoxal 5'-?phosphate (monohydrate) (Standard)

Sign In for Pricing
View Details