Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin heavy variable 7-81 (HV781), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin heavy variable 7-81 (HV781), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin heavy variable 7-81 IGHV7-81

UniProt

A0A0B4J1V7

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGHEVKQPGASVKVSCKASGYSFTTYGMNWVPQAPGQGLEWMGWFNTYTGNPTYAQGFTGRFVFSMDTSASTAYLQISSLKAEDMAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFIB (NM_001190737) Human Over-expression Lysate
LY434274 100 µg

NFIB (NM_001190737) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CXCL16 (Chemokine C-X-C-Motif Ligand 16) ELISA Kit
E-EL-H6274-01 24 Tests

Human CXCL16 (Chemokine C-X-C-Motif Ligand 16) ELISA Kit

Sign In for Pricing
View Details
Human CXCL16 (Chemokine C-X-C-Motif Ligand 16) ELISA Kit
E-EL-H6274-02 48 Tests

Human CXCL16 (Chemokine C-X-C-Motif Ligand 16) ELISA Kit

Sign In for Pricing
View Details
Human CXCL16 (Chemokine C-X-C-Motif Ligand 16) ELISA Kit
E-EL-H6274-03 96 Tests

Human CXCL16 (Chemokine C-X-C-Motif Ligand 16) ELISA Kit

Sign In for Pricing
View Details
Pixantrone Dimaleate
TRC-P552500-10MG 10 mg

Pixantrone Dimaleate

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/11), CF640R conjugate, 0.1mg/mL
BNC400011-100 1x 100 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details