Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-74 (HV374), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-74 (HV374), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-74 IGHV3-74

UniProt

A0A0B4J1X5

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMHWVRQAPGKGLVWVSRINSDGSSTSYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bleomycin Hydrolase (BH, BLMH, BMH)
B2105-60 100 µg

Bleomycin Hydrolase (BH, BLMH, BMH)

Sign In for Pricing
View Details
Mmu-miR-665-3p miRNA Antagomir
CIN0333-01 10 nmol

Mmu-miR-665-3p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-665-3p miRNA Antagomir
CIN0333-02 20 nmol

Mmu-miR-665-3p miRNA Antagomir

Sign In for Pricing
View Details
IQGAP2 Rabbit Monoclonal Antibody [Clone ID: 23GB2015]
TA424900S 20 µL

IQGAP2 Rabbit Monoclonal Antibody [Clone ID: 23GB2015]

Sign In for Pricing
View Details
CENPI siRNA (Mouse)
CRN0590-01 15 nmol

CENPI siRNA (Mouse)

Sign In for Pricing
View Details
CENPI siRNA (Mouse)
CRN0590-02 30 nmol

CENPI siRNA (Mouse)

Sign In for Pricing
View Details