Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 9-49 (LV949), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 9-49 (LV949), Biotinylated spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 9-49 IGLV9-49

UniProt

A0A0B4J1Y8

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQPPSASASLGASVTLTCTLSSGYSNYKVDWYQQRPGKGPRFVMRVGTGGIVGSKGDGIPDRFSVLGSGLNRYLTIKNIQEEDESDYHCGADHGSGSNFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H4 (Acetyl Lys12) Rabbit Polyclonal Antibody
MBS8503194-01 0.1 mg

Histone H4 (Acetyl Lys12) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H4 (Acetyl Lys12) Rabbit Polyclonal Antibody
MBS8503194-02 0.1 mL (AF635)

Histone H4 (Acetyl Lys12) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H4 (Acetyl Lys12) Rabbit Polyclonal Antibody
MBS8503194-03 0.1 mL (AF610)

Histone H4 (Acetyl Lys12) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H4 (Acetyl Lys12) Rabbit Polyclonal Antibody
MBS8503194-04 0.1 mL (AF405S)

Histone H4 (Acetyl Lys12) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H4 (Acetyl Lys12) Rabbit Polyclonal Antibody
MBS8503194-05 0.1 mL (AF405L)

Histone H4 (Acetyl Lys12) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Histone H4 (Acetyl Lys12) Rabbit Polyclonal Antibody
MBS8503194-06 0.1 mL (AF546)

Histone H4 (Acetyl Lys12) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details