Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-72 (HV372), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-72 (HV372), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-72 IGHV3-72

UniProt

A0A0B4J1Y9

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVGRTRNKANSYTTEYAASVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin (Hyb8), 0.2mg/mL
BNUB0400-500 1x 500 µL

Biotin (Hyb8), 0.2mg/mL

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD23 Antibody[EBVCS2]
E-AB-F1382Q-01 20 Tests

Elab Fluor® Violet 450 Anti-Human CD23 Antibody[EBVCS2]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD23 Antibody[EBVCS2]
E-AB-F1382Q-02 100 Tests

Elab Fluor® Violet 450 Anti-Human CD23 Antibody[EBVCS2]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Human CD23 Antibody[EBVCS2]
E-AB-F1382Q-03 2x 100 Tests

Elab Fluor® Violet 450 Anti-Human CD23 Antibody[EBVCS2]

Sign In for Pricing
View Details
malE Mouse Monoclonal Antibody [Clone ID: 6E4]
AM00088PU-N 100 µg

malE Mouse Monoclonal Antibody [Clone ID: 6E4]

Sign In for Pricing
View Details
MIR1273d Human qPCR Primer Pair (MI0014254)
HP300695 200 Reactions

MIR1273d Human qPCR Primer Pair (MI0014254)

Sign In for Pricing
View Details