Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-72 (HV372), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-72 (HV372), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-72 IGHV3-72

UniProt

A0A0B4J1Y9

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVGRTRNKANSYTTEYAASVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDX2 Antibody
KC-2433-01 50 μL

CDX2 Antibody

Sign In for Pricing
View Details
CDX2 Antibody
KC-2433-02 100 µL

CDX2 Antibody

Sign In for Pricing
View Details
CDX2 Antibody
KC-2433-03 1 mL

CDX2 Antibody

Sign In for Pricing
View Details
Human TBC1D1 activation kit by CRISPRa
GA108133 1 Kit

Human TBC1D1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Ileum
CS804164 5x 5 µm

Tissue FFPE Sections, Ileum

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: sigmoid
CS703802 5x 5 µm

Tissue FFPE Sections, Colon: sigmoid

Sign In for Pricing
View Details