Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-72 (HV372), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-72 (HV372), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-72 IGHV3-72

UniProt

A0A0B4J1Y9

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVGRTRNKANSYTTEYAASVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hordein Microplate Assay Kit
MBS4504329-01 100 Assays

Hordein Microplate Assay Kit

Sign In for Pricing
View Details
Hordein Microplate Assay Kit
MBS4504329-02 5x 100 Assays

Hordein Microplate Assay Kit

Sign In for Pricing
View Details
Hordein Microplate Assay Kit
MBS4504329-03 10x 100 Assays

Hordein Microplate Assay Kit

Sign In for Pricing
View Details
SRA1 polyclonal antibody
BS60560-01 50 µL

SRA1 polyclonal antibody

Sign In for Pricing
View Details
SRA1 polyclonal antibody
BS60560-02 100 µL

SRA1 polyclonal antibody

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to CDKN2A
sAP-0906 50 µg

Mouse Monoclonal Antibody to CDKN2A

Sign In for Pricing
View Details