Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 2 (TVA2), Biotinylated

This Recombinant Human T cell receptor alpha variable 2 (TVA2), Biotinylated spans the amino acid sequence from region 26-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 2 TRAV2

UniProt

A0A0B4J234

Expression Region

26-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KDQVFQPSTVASSEGAVVEIFCNHSVSNAYNFFWYLHFPGCAPRLLVKGSKPSQQGRYNMTYERFSSSLLILQVREADAAVYYCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desoxycortisol antibody
20-RDIWDES 1 mL

Desoxycortisol antibody

Sign In for Pricing
View Details
THAP7 Protein Vector (Mouse) (pPM-C-HA)
46635024 500 ng

THAP7 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
IRX1 (NM_024337) Human Over-expression Lysate
LS079192 100 µg

IRX1 (NM_024337) Human Over-expression Lysate

Sign In for Pricing
View Details
2-Hydroxy Ethynyl Estradiol
013743 1 mg

2-Hydroxy Ethynyl Estradiol

Sign In for Pricing
View Details
DACH1 Polyclonal Antibody
RD75755A-01 20 µL

DACH1 Polyclonal Antibody

Sign In for Pricing
View Details
DACH1 Polyclonal Antibody
RD75755A-02 60 μL

DACH1 Polyclonal Antibody

Sign In for Pricing
View Details