Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-2 (TVAM2), Biotinylated

This Recombinant Human T cell receptor alpha variable 13-2 (TVAM2), Biotinylated spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-2 TRAV13-2

UniProt

A0A0B4J235

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ESVGLHLPTLSVQEGDNSIINCAYSNSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQPGDSAVYFCAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Remimazolam
TRC-R143600-5MG 5 mg

Remimazolam

Sign In for Pricing
View Details
Human GTPBP8 activation kit by CRISPRa
GA109219 1 Kit

Human GTPBP8 activation kit by CRISPRa

Sign In for Pricing
View Details
STK3 (NM_006281) Human Recombinant Protein
TP303897M 100 µg

STK3 (NM_006281) Human Recombinant Protein

Sign In for Pricing
View Details
Human SLC5A9 activation kit by CRISPRa
GA116329 1 Kit

Human SLC5A9 activation kit by CRISPRa

Sign In for Pricing
View Details
L-(-)-3-Phenyllactic Acid
TRC-P335553-500MG 500 mg

L-(-)-3-Phenyllactic Acid

Sign In for Pricing
View Details
Human FAM71B activation kit by CRISPRa
GA115874 1 Kit

Human FAM71B activation kit by CRISPRa

Sign In for Pricing
View Details