Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 13-2 (TVAM2), Biotinylated

This Recombinant Human T cell receptor alpha variable 13-2 (TVAM2), Biotinylated spans the amino acid sequence from region 22-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 13-2 TRAV13-2

UniProt

A0A0B4J235

Expression Region

22-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ESVGLHLPTLSVQEGDNSIINCAYSNSASDYFIWYKQESGKGPQFIIDIRSNMDKRQGQRVTVLLNKTVKHLSLQIAATQPGDSAVYFCAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin D (Tumor Marker) (CTSD/2781), CF594 conjugate, 0.1mg/mL
BNC942781-500 1x 500 µL

Cathepsin D (Tumor Marker) (CTSD/2781), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/2092R), CF647 conjugate, 0.1mg/mL
BNC472092-100 1x 100 µL

P53 Tumor Suppressor Protein (TP53/2092R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UGT3A2 (NM_001168316) Human Over-expression Lysate
LY433167 100 µg

UGT3A2 (NM_001168316) Human Over-expression Lysate

Sign In for Pricing
View Details
Ubash3a Mouse Gene Knockout Kit (CRISPR)
KN518557 1 Kit

Ubash3a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RNF32 Antibody
OC-226-01 50 μL

RNF32 Antibody

Sign In for Pricing
View Details
RNF32 Antibody
OC-226-02 100 µL

RNF32 Antibody

Sign In for Pricing
View Details