Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-2 (TVA82), Biotinylated

This Recombinant Human T cell receptor alpha variable 8-2 (TVA82), Biotinylated spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-2 TRAV8-2

UniProt

A0A0B4J237

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQLDSHVSVSEGTPVLLRCNYSSSYSPSLFWYVQHPNKGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCVVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (Trifluoroacetamido) pyrrolidine hydrochloride
sc-283602 1 g

3- (Trifluoroacetamido) pyrrolidine hydrochloride

Sign In for Pricing
View Details
Lentiviral mouse Abcb1a shRNA (UAS) - Lentiviral mouse Abcb1a shRNA (UAS, iRFP) (25)
GTR15301181 1 Vial

Lentiviral mouse Abcb1a shRNA (UAS) - Lentiviral mouse Abcb1a shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Olr1132 siRNA Oligos set (Rat)
33695176 3x 5 nmol

Olr1132 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Morg1/WDR83 Rabbit Polyclonal Antibody (Biotin)
orb2580016 100 µg

Morg1/WDR83 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
HI-DOSER powder doser for higher dosing speeds, programmable (capacity approx. 1 l)
5813-1L 1 Piece (1 L)

HI-DOSER powder doser for higher dosing speeds, programmable (capacity approx. 1 l)

Sign In for Pricing
View Details
Monoclonal Creatine Phosphokinase-BB (CK-BB) Antibody - Without BSA and Azide, Clone: 2ba6
APR07316G 0.1mg

Monoclonal Creatine Phosphokinase-BB (CK-BB) Antibody - Without BSA and Azide, Clone: 2ba6

Sign In for Pricing
View Details