Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-2 (TVA82), Biotinylated

This Recombinant Human T cell receptor alpha variable 8-2 (TVA82), Biotinylated spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-2 TRAV8-2

UniProt

A0A0B4J237

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQLDSHVSVSEGTPVLLRCNYSSSYSPSLFWYVQHPNKGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCVVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm7849 ORF Vector (Mouse) (pORF)
ORF046216 1.0 µg DNA

Gm7849 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
LOC498460 (NM_001047931) Rat Tagged ORF Clone Lentiviral Particle
RR201576L3V 200 µL

LOC498460 (NM_001047931) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal CD81 Antibody (M38) [DyLight 488]
NBP1-44861G 0.1 mL

Mouse Monoclonal CD81 Antibody (M38) [DyLight 488]

Sign In for Pricing
View Details
SNAPIN (1-136, His-tag) Human Protein
AR50028PU-S 100 µg

SNAPIN (1-136, His-tag) Human Protein

Sign In for Pricing
View Details
PacBlue Anti-human CD4 Antibody *RPA-T4*
100411J1-AAT 500 Tests

PacBlue Anti-human CD4 Antibody *RPA-T4*

Sign In for Pricing
View Details
Recombinant Human Wnt/RSPO3 Agonist Protein CF
BT-WRSP3-050 50 µg

Recombinant Human Wnt/RSPO3 Agonist Protein CF

Sign In for Pricing
View Details