Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-2 (TVA82), Biotinylated

This Recombinant Human T cell receptor alpha variable 8-2 (TVA82), Biotinylated spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-2 TRAV8-2

UniProt

A0A0B4J237

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQLDSHVSVSEGTPVLLRCNYSSSYSPSLFWYVQHPNKGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCVVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ido2 (NM_145949) Mouse Tagged ORF Clone
MR206249 10 µg

Ido2 (NM_145949) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Siglec-E MAb (Clone 750620)
MAB5806-SP 25 µg

Mouse Siglec-E MAb (Clone 750620)

Sign In for Pricing
View Details
pUNO1-hSTING-N200
puno1-hsting-n200 20 µg

pUNO1-hSTING-N200

Sign In for Pricing
View Details
SERPINF2 (Alpha-2-antiplasmin, Alpha-2-AP, Alpha-2-plasmin Inhibitor, Alpha-2-PI, Serpin F2, AAP, PLI) (MaxLight 750) discontinued
133193-ML750 100 µL

SERPINF2 (Alpha-2-antiplasmin, Alpha-2-AP, Alpha-2-plasmin Inhibitor, Alpha-2-PI, Serpin F2, AAP, PLI) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Anti-Human LILRB4 Antibody-FITC Conjugate
DZ41337-FITC 200 µL/Vial

Anti-Human LILRB4 Antibody-FITC Conjugate

Sign In for Pricing
View Details
SAG Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
42974066 1.0 µg DNA

SAG Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details