Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 1-2 (TVA12), Biotinylated

This Recombinant Human T cell receptor alpha variable 1-2 (TVA12), Biotinylated spans the amino acid sequence from region 19-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 1-2 TRAV1-2

UniProt

A0A0B4J238

Expression Region

19-106

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (ICO-97), CF647 conjugate, 0.1mg/mL
BNC470758-100 1x 100 µL

Human IgG Immunoglobulin (ICO-97), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1orf31 (COA6) (NM_001012985) Human Over-expression Lysate
LC422946 20 µg

C1orf31 (COA6) (NM_001012985) Human Over-expression Lysate

Sign In for Pricing
View Details
Growth Arrest Specific Protein 7 (GAS7) (C-term) Rabbit Polyclonal Antibody
AP17417PU-N 400 µL

Growth Arrest Specific Protein 7 (GAS7) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
JNK2 (MAPK9) (NM_002752) Human Over-expression Lysate
LC400972 20 µg

JNK2 (MAPK9) (NM_002752) Human Over-expression Lysate

Sign In for Pricing
View Details
Benzyl 2-Acetamido-2-deoxy-4,6-O-benzylidene-a-D-galactopyranoside
TRC-B211675-50MG 50 mg

Benzyl 2-Acetamido-2-deoxy-4,6-O-benzylidene-a-D-galactopyranoside

Sign In for Pricing
View Details
VLDL Receptor (VLDLR) (NM_003383) Human Over-expression Lysate
LC401153 20 µg

VLDL Receptor (VLDLR) (NM_003383) Human Over-expression Lysate

Sign In for Pricing
View Details