Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 1-2 (TVA12), Biotinylated

This Recombinant Human T cell receptor alpha variable 1-2 (TVA12), Biotinylated spans the amino acid sequence from region 19-106. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 1-2 TRAV1-2

UniProt

A0A0B4J238

Expression Region

19-106

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BRUNOL4 (CELF4) activation kit by CRISPRa
GA111237 1 Kit

Human BRUNOL4 (CELF4) activation kit by CRISPRa

Sign In for Pricing
View Details
FKBP25 (FKBP3) (NM_002013) Human Over-expression Lysate
LY400736 100 µg

FKBP25 (FKBP3) (NM_002013) Human Over-expression Lysate

Sign In for Pricing
View Details
RNASE9 (NM_001110358) Human Over-expression Lysate
LY426322 100 µg

RNASE9 (NM_001110358) Human Over-expression Lysate

Sign In for Pricing
View Details
Topoisomerase (DNA) I, Mitochondrial (TOP1MT) (TOP1MT/568), CF405S conjugate, 0.1mg/mL
BNC040489-500 1x 500 µL

Topoisomerase (DNA) I, Mitochondrial (TOP1MT) (TOP1MT/568), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BMP9 (GDF2) (N-term) Rabbit Polyclonal Antibody
AP11941PU-N 400 µL

BMP9 (GDF2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant ROCK1 Antibody
RC-4740-01 50 μL

Recombinant ROCK1 Antibody

Sign In for Pricing
View Details