Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 10 (TVA10), Biotinylated

This Recombinant Human T cell receptor alpha variable 10 (TVA10), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 10 TRAV10

UniProt

A0A0B4J240

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGRGPVSLTIMTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(3-Methanesulfonylphenyl) hydrazine
MMA30393-01 50 mg

(3-Methanesulfonylphenyl) hydrazine

Sign In for Pricing
View Details
(3-Methanesulfonylphenyl) hydrazine
MMA30393-02 0.5 g

(3-Methanesulfonylphenyl) hydrazine

Sign In for Pricing
View Details
Ptpdc1 Antibody
orb860910 2 mg

Ptpdc1 Antibody

Sign In for Pricing
View Details
VEGF-C discontinued
543704-01 30ul

VEGF-C discontinued

Sign In for Pricing
View Details
VEGF-C discontinued
543704-02 100 µL

VEGF-C discontinued

Sign In for Pricing
View Details
CDC45 (Cell Division Control Protein 45 Homolog, PORC-PI-1, CDC45, CDC45L, CDC45L2, UNQ374/PRO710)
406208-01 50 µL

CDC45 (Cell Division Control Protein 45 Homolog, PORC-PI-1, CDC45, CDC45L, CDC45L2, UNQ374/PRO710)

Sign In for Pricing
View Details