Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 3 (TVA3), Biotinylated

This Recombinant Human T cell receptor alpha variable 3 (TVA3), Biotinylated spans the amino acid sequence from region 21-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 3 TRAV3

UniProt

A0A0B4J244

Expression Region

21-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVAQPEDQVNVAEGNPLTVKCTYSVSGNPYLFWYVQYPNRGLQFLLKYITGDNLVKGSYGFEAEFNKSQTSFHLKKPSALVSDSALYFCAVRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Timd2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
46704065 1.0 µg DNA

Timd2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit Polyclonal C11orf68 Antibody
NBP2-82819-0.1mL 0.1 mL

Rabbit Polyclonal C11orf68 Antibody

Sign In for Pricing
View Details
DDOST ELISA Kit (Human) (OKEH01486)
OKEH01486 96 Well

DDOST ELISA Kit (Human) (OKEH01486)

Sign In for Pricing
View Details
PFK-2 br/pl Double Nickase Plasmid (h2)
sc-404532-NIC-2 20 µg

PFK-2 br/pl Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
TRADD Rabbit Polyclonal Antibody
TA368888 100 µL

TRADD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sheep Interleukin 2 Receptor β ELISA kit
GTR10453306 96 Well

Sheep Interleukin 2 Receptor β ELISA kit

Sign In for Pricing
View Details