Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-1 (TVAL1), Biotinylated

This Recombinant Human T cell receptor alpha variable 12-1 (TVAL1), Biotinylated spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-1 TRAV12-1

UniProt

A0A0B4J245

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QRKEVEQDPGPFNVPEGATVAFNCTYSNSASQSFFWYRQDCRKEPKLLMSVYSSGNEDGRFTAQLNRASQYISLLIRDSKLSDSATYLCVVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

β-Interleukin I (163-171), human
A1026-10 10 mg

β-Interleukin I (163-171), human

Sign In for Pricing
View Details
Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial
orb3003881-01 20 µg

Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

Sign In for Pricing
View Details
Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial
orb3003881-02 100 µg

Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

Sign In for Pricing
View Details
Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial
orb3003881-03 1 mg

Recombinant Human TATA-binding protein-associated factor 2N (TAF15), partial

Sign In for Pricing
View Details
ATRN Protein Vector (Rat) (pPM-C-His)
PV255489 500 ng

ATRN Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Tmem5 (NM_153059) Mouse Tagged ORF Clone
MG207084 10 µg

Tmem5 (NM_153059) Mouse Tagged ORF Clone

Sign In for Pricing
View Details