Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 1-1 (TVA11), Biotinylated

This Recombinant Human T cell receptor alpha variable 1-1 (TVA11), Biotinylated spans the amino acid sequence from region 19-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 1-1 TRAV1-1

UniProt

A0A0B4J248

Expression Region

19-108

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSLEQPSEVTAVEGAIVQINCTYQTSGFYGLSWYQQHDGGAPTFLSYNALDGLEETGRFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Freeze Dryer BFFT-315-B
BFFT-315-B 1 Unit

Freeze Dryer BFFT-315-B

Sign In for Pricing
View Details
ALKBH6 Human Gene Knockout Kit (CRISPR)
KN421937 1 Kit

ALKBH6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EHMT2/G9A (EHMT2) Human Gene Knockout Kit (CRISPR)
KN219200LP 1 Kit

EHMT2/G9A (EHMT2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SynaptoRedTMC1 5x1mg
#70041 5x 1 mg

SynaptoRedTMC1 5x1mg

Sign In for Pricing
View Details
Tris-NTA per-Tert-butyl Ester
TRC-T875550-25MG 25 mg

Tris-NTA per-Tert-butyl Ester

Sign In for Pricing
View Details
HSPA4L Polyclonal Antibody
E-AB-52003-01 20 µL

HSPA4L Polyclonal Antibody

Sign In for Pricing
View Details