Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 1-1 (TVA11), Biotinylated

This Recombinant Human T cell receptor alpha variable 1-1 (TVA11), Biotinylated spans the amino acid sequence from region 19-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 1-1 TRAV1-1

UniProt

A0A0B4J248

Expression Region

19-108

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSLEQPSEVTAVEGAIVQINCTYQTSGFYGLSWYQQHDGGAPTFLSYNALDGLEETGRFSSFLSRSDSYGYLLLQELQMKDSASYFCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal PVRIG Antibody (2334B) [PE/Atto594]
FAB93652PEATT594 0.1 mL

Rabbit Monoclonal PVRIG Antibody (2334B) [PE/Atto594]

Sign In for Pricing
View Details
Chn2 Rat shRNA Plasmid (Locus ID 84031)
TL711674 1 Kit

Chn2 Rat shRNA Plasmid (Locus ID 84031)

Sign In for Pricing
View Details
Gnat2 Mouse shRNA Plasmid (Locus ID 14686)
TR516061 1 Kit

Gnat2 Mouse shRNA Plasmid (Locus ID 14686)

Sign In for Pricing
View Details
OMD Antibody, HRP conjugated
A30331-50UG 50 µg

OMD Antibody, HRP conjugated

Sign In for Pricing
View Details
AGO1 Knockout Raji Polyclonal Cells
ARG21093 1 Million

AGO1 Knockout Raji Polyclonal Cells

Sign In for Pricing
View Details
Recombinant Human Coiled-coil domain-containing protein 102B (CCDC102B)
MBS1399907-01 0.02 mg (E-Coli)

Recombinant Human Coiled-coil domain-containing protein 102B (CCDC102B)

Sign In for Pricing
View Details