Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 5 (TVA5), Biotinylated

This Recombinant Human T cell receptor alpha variable 5 (TVA5), Biotinylated spans the amino acid sequence from region 23-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 5 TRAV5

UniProt

A0A0B4J249

Expression Region

23-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD300C (NM_006678) Human Recombinant Protein
TP720373L 500 µg

CD300C (NM_006678) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse M-CSF/CSF1 Recombinant Rabbit monoclonal Antibody
HA723792 100 µL

Mouse M-CSF/CSF1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
BLBP (FABP7) Mouse Monoclonal Antibody [Clone ID: AT1D1]
AM09059PU-N 100 µL

BLBP (FABP7) Mouse Monoclonal Antibody [Clone ID: AT1D1]

Sign In for Pricing
View Details
CHD3 Rabbit Polyclonal Antibody
TA371591 100 µL

CHD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse PSGL-1/CD162 Protein (aa 1-307, Fc Tag)
PKSM040492 100 µg

Recombinant Mouse PSGL-1/CD162 Protein (aa 1-307, Fc Tag)

Sign In for Pricing
View Details
DNAJC11 Human Gene Knockout Kit (CRISPR)
KN402839 1 Kit

DNAJC11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details