Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 5 (TVA5), Biotinylated

This Recombinant Human T cell receptor alpha variable 5 (TVA5), Biotinylated spans the amino acid sequence from region 23-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 5 TRAV5

UniProt

A0A0B4J249

Expression Region

23-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMPK beta 1 (PRKAB1) Mouse Monoclonal Antibody [Clone ID: OTI8D5]
CF813121 100 µg

AMPK beta 1 (PRKAB1) Mouse Monoclonal Antibody [Clone ID: OTI8D5]

Sign In for Pricing
View Details
FABP2 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP2-3), 0.2mg/mL
BNUB2226-500 1x 500 µL

FABP2 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP2-3), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Human CD2 Protein (His Tag)
PKSH031320-01 100 µg

Recombinant Human CD2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CD2 Protein (His Tag)
PKSH031320-02 1 mg

Recombinant Human CD2 Protein (His Tag)

Sign In for Pricing
View Details
Human Sialidase 2, Cytosolic (SIAL2) ELISA Kit
RD-SIAL2-Hu-01 96 Tests

Human Sialidase 2, Cytosolic (SIAL2) ELISA Kit

Sign In for Pricing
View Details
Human Sialidase 2, Cytosolic (SIAL2) ELISA Kit
RD-SIAL2-Hu-02 48 Tests

Human Sialidase 2, Cytosolic (SIAL2) ELISA Kit

Sign In for Pricing
View Details