Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 39 (TVA39), Biotinylated

This Recombinant Human T cell receptor alpha variable 39 (TVA39), Biotinylated spans the amino acid sequence from region 19-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 39 TRAV39

UniProt

A0A0B4J263

Expression Region

19-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ELKVEQNPLFLSMQEGKNYTIYCNYSTTSDRLYWYRQDPGKSLESLFVLLSNGAVKQEGRLMASLDTKARLSTLHITAAVHDLSATYFCAVD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Apolipoprotein E/ApoE Antibody (WUE-4) [HRP]
NB110-60531H 0.1 mL

Mouse Monoclonal Apolipoprotein E/ApoE Antibody (WUE-4) [HRP]

Sign In for Pricing
View Details
Cytochrome P450 Reductase (Por) Antibody (APC)
abx447513-01 100 µg

Cytochrome P450 Reductase (Por) Antibody (APC)

Sign In for Pricing
View Details
Cytochrome P450 Reductase (Por) Antibody (APC)
abx447513-02 250 µL

Cytochrome P450 Reductase (Por) Antibody (APC)

Sign In for Pricing
View Details
CDS2 CRISPRa sgRNA lentivector (set of three targets)(Rat)
15764126 3x 1.0µg DNA

CDS2 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
IKK alpha, C3 (IkappaB Kinase alpha, IKKa) (MaxLight 490) discontinued
I3000-09-ML490 100 µL

IKK alpha, C3 (IkappaB Kinase alpha, IKKa) (MaxLight 490) discontinued

Sign In for Pricing
View Details
TMEM117 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
46873111 3x 1.0 µg

TMEM117 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details