Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 26-2 (TVAZ2), Biotinylated

This Recombinant Human T cell receptor alpha variable 26-2 (TVAZ2), Biotinylated spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 26-2 TRAV26-2

UniProt

A0A0B4J265

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPNSMESNEEEPVHLPCNHSTISGTDYIHWYRQLPSQGPEYVIHGLTSNVNNRMASLAIAEDRKSSTLILHRATLRDAAVYYCILRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granzyme B Antibody
8C0215-AAT 50 µg

Granzyme B Antibody

Sign In for Pricing
View Details
CCKBR Human Gene Knockout Kit (CRISPR)
KN400676 1 Kit

CCKBR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FUBP3 Rabbit Polyclonal Antibody
AP01471PU-N 100 µg

FUBP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZYG11BL (ZER1) (NM_006336) Human Recombinant Protein
TP308590L 1 mg

ZYG11BL (ZER1) (NM_006336) Human Recombinant Protein

Sign In for Pricing
View Details
Desmocollin 2 (DSC2) (NM_024422) Human Recombinant Protein
TP309218M 100 µg

Desmocollin 2 (DSC2) (NM_024422) Human Recombinant Protein

Sign In for Pricing
View Details
1,5-Diamino-2-chloro-4,8-dihydroxy-9,10-anthracenedione
TRC-D678823-100MG 100 mg

1,5-Diamino-2-chloro-4,8-dihydroxy-9,10-anthracenedione

Sign In for Pricing
View Details