Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 4 (TVA4), Biotinylated

This Recombinant Human T cell receptor alpha variable 4 (TVA4), Biotinylated spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 4 TRAV4

UniProt

A0A0B4J268

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI9A2]
CF805096 100 µg

p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI9A2]

Sign In for Pricing
View Details
Proteinase Activated Receptor 4 (F2RL3) (NM_003950) Human Over-expression Lysate
LY401297 100 µg

Proteinase Activated Receptor 4 (F2RL3) (NM_003950) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Caspase 9
Y058225 100 µL

Anti-Caspase 9

Sign In for Pricing
View Details
(E)-3-(3-(2-Ethoxyphenyl)-3-oxoprop-1-en-1-yl)quinolin-2(1H)-one
TRC-E123668-100MG 100 mg

(E)-3-(3-(2-Ethoxyphenyl)-3-oxoprop-1-en-1-yl)quinolin-2(1H)-one

Sign In for Pricing
View Details
Upamostat
TRC-U220220-500MG 500 mg

Upamostat

Sign In for Pricing
View Details
Micro Centrifuge Tubes
C2007 500 Sheets/Pack

Micro Centrifuge Tubes

Sign In for Pricing
View Details