Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 4 (TVA4), Biotinylated

This Recombinant Human T cell receptor alpha variable 4 (TVA4), Biotinylated spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 4 TRAV4

UniProt

A0A0B4J268

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMAD1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B9]
TA809092AM 100 µL

SMAD1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B9]

Sign In for Pricing
View Details
RRS1 Human Gene Knockout Kit (CRISPR)
KN401453 1 Kit

RRS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TRIM58 activation kit by CRISPRa
GA108610 1 Kit

Human TRIM58 activation kit by CRISPRa

Sign In for Pricing
View Details
3-Deoxy-D-erythro-hexos-2-ulose-bis-benzoylhydrazone-13C6
TRC-D232903-5MG 5 mg

3-Deoxy-D-erythro-hexos-2-ulose-bis-benzoylhydrazone-13C6

Sign In for Pricing
View Details
PPAR gamma (PPARG) Mouse Monoclonal Antibody [Clone ID: 3A4A9]
AM06243SU-N 100 µL

PPAR gamma (PPARG) Mouse Monoclonal Antibody [Clone ID: 3A4A9]

Sign In for Pricing
View Details
Aconitase 2 (ACO2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G10]
TA500913AM 100 µL

Aconitase 2 (ACO2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3G10]

Sign In for Pricing
View Details