Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 4 (TVA4), Biotinylated

This Recombinant Human T cell receptor alpha variable 4 (TVA4), Biotinylated spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 4 TRAV4

UniProt

A0A0B4J268

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQGYKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSH3BP1 Antibody / ABI1
R30167 100 µg

SSH3BP1 Antibody / ABI1

Sign In for Pricing
View Details
Mouse Anti-Human CD29 mAb (PE/Cy7) [TS2/16.2.1]
E2781442 100 Tests

Mouse Anti-Human CD29 mAb (PE/Cy7) [TS2/16.2.1]

Sign In for Pricing
View Details
PDE4C siRNA (m)
sc-152129 10 µM

PDE4C siRNA (m)

Sign In for Pricing
View Details
Semaglutide Impurity 77
RM-S400077-01 10 mg

Semaglutide Impurity 77

Sign In for Pricing
View Details
Semaglutide Impurity 77
RM-S400077-02 25 mg

Semaglutide Impurity 77

Sign In for Pricing
View Details
Semaglutide Impurity 77
RM-S400077-03 50 mg

Semaglutide Impurity 77

Sign In for Pricing
View Details