Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-3 (TVAL3), Biotinylated

This Recombinant Human T cell receptor alpha variable 12-3 (TVAL3), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-3 TRAV12-3

UniProt

A0A0B4J271

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNP23 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1021608 1.0 µg DNA

IFNP23 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit Apoptosis Signal Regulating Kinase 1 (MAP3K5) ELISA Kit
abx362860 96 Well

Rabbit Apoptosis Signal Regulating Kinase 1 (MAP3K5) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal CCL8/MCP-2 Antibody (CCL8/3686) [DyLight 405]
NBP3-14174V 0.1 mL

Mouse Monoclonal CCL8/MCP-2 Antibody (CCL8/3686) [DyLight 405]

Sign In for Pricing
View Details
CD1a Antibody (RPE)
orb435184 25 Tests

CD1a Antibody (RPE)

Sign In for Pricing
View Details
GPR156 Human shRNA Plasmid Kit (Locus ID 165829)
TL304244 1 Kit

GPR156 Human shRNA Plasmid Kit (Locus ID 165829)

Sign In for Pricing
View Details
DGY-06-116
MBS133540 Inquire

DGY-06-116

Sign In for Pricing
View Details