Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 12-3 (TVAL3), Biotinylated

This Recombinant Human T cell receptor alpha variable 12-3 (TVAL3), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 12-3 TRAV12-3

UniProt

A0A0B4J271

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQKEVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Diamino-6-hydroxy-5-thiocyanopyrimidine
sc-213993 1 g

2,4-Diamino-6-hydroxy-5-thiocyanopyrimidine

Sign In for Pricing
View Details
SIDT2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
43750061 1.0 µg DNA

SIDT2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Ifnb1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
24266114 3x 1.0 µg

Ifnb1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Artificial Lung Fluid
H2530-01 200 mL

Artificial Lung Fluid

Sign In for Pricing
View Details
Artificial Lung Fluid
H2530-02 600 mL

Artificial Lung Fluid

Sign In for Pricing
View Details
Artificial Lung Fluid
H2530-03 1000 mL

Artificial Lung Fluid

Sign In for Pricing
View Details