Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 24 (TVA24), Biotinylated

This Recombinant Human T cell receptor alpha variable 24 (TVA24), Biotinylated spans the amino acid sequence from region 23-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 24 TRAV24

UniProt

A0A0B4J272

Expression Region

23-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKGRISATLNTKEGYSYLYIKGSQPEDSATYLCAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Malonylurea-cyclopentene-butanoic acid
orb3132745-01 10 mg

Malonylurea-cyclopentene-butanoic acid

Sign In for Pricing
View Details
Malonylurea-cyclopentene-butanoic acid
orb3132745-02 50 mg

Malonylurea-cyclopentene-butanoic acid

Sign In for Pricing
View Details
KD-Validated Anti-Catalase Rabbit Monoclonal Antibody
AGI1802-100 100 µL

KD-Validated Anti-Catalase Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human ITGB2
orb1099050-01 50 µg

Recombinant Human ITGB2

Sign In for Pricing
View Details
Recombinant Human ITGB2
orb1099050-02 100 µg

Recombinant Human ITGB2

Sign In for Pricing
View Details
Recombinant Human ITGB2
orb1099050-03 200 µg

Recombinant Human ITGB2

Sign In for Pricing
View Details