Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 34 (TVA34), Biotinylated

This Recombinant Human T cell receptor alpha variable 34 (TVA34), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 34 TRAV34

UniProt

A0A0B4J273

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QELEQSPQSLIVQEGKNLTINCTSSKTLYGLYWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSSLHITASQPSHAGIYLCGAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti Human Igg4 Monoclonal Antibody
CABT-48879MH 0.2 mg

Mouse Anti Human Igg4 Monoclonal Antibody

Sign In for Pricing
View Details
Rat Scpep1/Retinoid-inducible serine carboxypeptidase ELISA Kit
MBS2904086-01 48 Well

Rat Scpep1/Retinoid-inducible serine carboxypeptidase ELISA Kit

Sign In for Pricing
View Details
Rat Scpep1/Retinoid-inducible serine carboxypeptidase ELISA Kit
MBS2904086-02 96 Well

Rat Scpep1/Retinoid-inducible serine carboxypeptidase ELISA Kit

Sign In for Pricing
View Details
Rat Scpep1/Retinoid-inducible serine carboxypeptidase ELISA Kit
MBS2904086-03 5x 96 Well

Rat Scpep1/Retinoid-inducible serine carboxypeptidase ELISA Kit

Sign In for Pricing
View Details
Rat Scpep1/Retinoid-inducible serine carboxypeptidase ELISA Kit
MBS2904086-04 10x 96 Well

Rat Scpep1/Retinoid-inducible serine carboxypeptidase ELISA Kit

Sign In for Pricing
View Details
ROBO2 Rabbit pAb
E2862140 100 µL

ROBO2 Rabbit pAb

Sign In for Pricing
View Details