Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 34 (TVA34), Biotinylated

This Recombinant Human T cell receptor alpha variable 34 (TVA34), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 34 TRAV34

UniProt

A0A0B4J273

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QELEQSPQSLIVQEGKNLTINCTSSKTLYGLYWYKQKYGEGLIFLMMLQKGGEEKSHEKITAKLDEKKQQSSLHITASQPSHAGIYLCGAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NTM siRNA (Rat)
orb1832491-01 15 nmol

NTM siRNA (Rat)

Sign In for Pricing
View Details
NTM siRNA (Rat)
orb1832491-02 30 nmol

NTM siRNA (Rat)

Sign In for Pricing
View Details
ANXA2 Adenovirus (Human)
12069052 1.0 mL

ANXA2 Adenovirus (Human)

Sign In for Pricing
View Details
Human CHMP4A Protein
B2011943 10 µg

Human CHMP4A Protein

Sign In for Pricing
View Details
LRP8
567547-01 50 µg

LRP8

Sign In for Pricing
View Details
LRP8
567547-02 100 µg

LRP8

Sign In for Pricing
View Details