Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 20 (TVA20), Biotinylated

This Recombinant Human T cell receptor alpha variable 20 (TVA20), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 20 TRAV20

UniProt

A0A0B4J274

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGTA Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-7830R-BF488 100 µL

SGTA Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
TTTY8 siRNA Oligos set (Human)
48783171 3x 5 nmol

TTTY8 siRNA Oligos set (Human)

Sign In for Pricing
View Details
TRPC6P ORF Vector (Human) (pORF)
ORF035166 1.0 µg DNA

TRPC6P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
1,2-Bis(4-bromophenoxy)ethane
TRC-B400056-5MG 5 mg

1,2-Bis(4-bromophenoxy)ethane

Sign In for Pricing
View Details
Rat HN1 shRNA Plasmid
abx988279-01 150 µg

Rat HN1 shRNA Plasmid

Sign In for Pricing
View Details
Rat HN1 shRNA Plasmid
abx988279-02 300 µg

Rat HN1 shRNA Plasmid

Sign In for Pricing
View Details