Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 20 (TVA20), Biotinylated

This Recombinant Human T cell receptor alpha variable 20 (TVA20), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 20 TRAV20

UniProt

A0A0B4J274

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EDQVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ddx42 (NM_001107059) Rat Tagged ORF Clone Lentiviral Particle
RR203196L3V 200 µL

Ddx42 (NM_001107059) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Pdk3 Antibody (C-term)
E45R07135G-1 100 µL

Mouse Pdk3 Antibody (C-term)

Sign In for Pricing
View Details
CXorf65 (NM_001025265) Human Over-expression Lysate
LS158830 100 µg

CXorf65 (NM_001025265) Human Over-expression Lysate

Sign In for Pricing
View Details
4-Chloro-4'-ethylbenzophenone
sc-323072 5 g

4-Chloro-4'-ethylbenzophenone

Sign In for Pricing
View Details
Mouse Monoclonal Plakophilin-3 Antibody (23E3/4) [DyLight 650]
NBP1-97674C 0.1 mL

Mouse Monoclonal Plakophilin-3 Antibody (23E3/4) [DyLight 650]

Sign In for Pricing
View Details
Human/Mouse/Rat NMDA NR2A Polyclonal Ab
PPS054 50 µL

Human/Mouse/Rat NMDA NR2A Polyclonal Ab

Sign In for Pricing
View Details