Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 17 (TVA17), Biotinylated

This Recombinant Human T cell receptor alpha variable 17 (TVA17), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 17 TRAV17

UniProt

A0A0B4J275

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC11 (NM_052884) Human Tagged ORF Clone Lentiviral Particle
RC217861L4V 200 µL

SIGLEC11 (NM_052884) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Siglec-15 Antibody
MBS9523320-01 0.04 mL

Siglec-15 Antibody

Sign In for Pricing
View Details
Siglec-15 Antibody
MBS9523320-02 0.1 mL

Siglec-15 Antibody

Sign In for Pricing
View Details
Siglec-15 Antibody
MBS9523320-03 0.2 mL

Siglec-15 Antibody

Sign In for Pricing
View Details
Siglec-15 Antibody
MBS9523320-04 5x 0.2 mL

Siglec-15 Antibody

Sign In for Pricing
View Details
Svil Rat siRNA Oligo Duplex (Locus ID 361256)
SR506358 1 Kit

Svil Rat siRNA Oligo Duplex (Locus ID 361256)

Sign In for Pricing
View Details