Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 17 (TVA17), Biotinylated

This Recombinant Human T cell receptor alpha variable 17 (TVA17), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 17 TRAV17

UniProt

A0A0B4J275

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQGEEDPQALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREKHSGRLRVTLDTSKKSSSLLITASRAADTASYFCATD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRD5A2 Recombinant Rabbit mAb
E43S45692 100 µL

SRD5A2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Hi-PCR® Fungal ITS Semi-Q PCR Kit
MBPCR096-50R 50 Reaction

Hi-PCR® Fungal ITS Semi-Q PCR Kit

Sign In for Pricing
View Details
Total Histone H3 Matched Antibody Pair
CST 78208S 1 Kit

Total Histone H3 Matched Antibody Pair

Sign In for Pricing
View Details
Poliovirus Receptor (PVR) Human Recombinant Protein
TP724018 100 µg

Poliovirus Receptor (PVR) Human Recombinant Protein

Sign In for Pricing
View Details
Dbc1 sgRNA CRISPR Lentivector set (Mouse)
K3531001 3x 1.0 µg

Dbc1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Fibulin 1 (FBLN1) Rabbit Polyclonal Antibody
TA323077 100 µL

Fibulin 1 (FBLN1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details