Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 22 (TVA22), Biotinylated

This Recombinant Human T cell receptor alpha variable 22 (TVA22), Biotinylated spans the amino acid sequence from region 22-110. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 22 TRAV22

UniProt

A0A0B4J277

Expression Region

22-110

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IQVEQSPPDLILQEGANSTLRCNFSDSVNNLQWFHQNPWGQLINLFYIPSGTKQNGRLSATTVATERYSLLYISSSQTTDSGVYFCAVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1A (PPP1CA) (NM_001008709) Human Over-expression Lysate
LC423356 20 µg

PPP1A (PPP1CA) (NM_001008709) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PLEC (Plectin) QuickTest ELISA Kit
MBS7619662-01 48 Well

Human PLEC (Plectin) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human PLEC (Plectin) QuickTest ELISA Kit
MBS7619662-02 96 Well

Human PLEC (Plectin) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human PLEC (Plectin) QuickTest ELISA Kit
MBS7619662-03 5x 96 Well

Human PLEC (Plectin) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human PLEC (Plectin) QuickTest ELISA Kit
MBS7619662-04 10x 96 Well

Human PLEC (Plectin) QuickTest ELISA Kit

Sign In for Pricing
View Details
TIMM50 Antibody
orb1265757 400 μl

TIMM50 Antibody

Sign In for Pricing
View Details