Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 21 (TVA21), Biotinylated

This Recombinant Human T cell receptor alpha variable 21 (TVA21), Biotinylated spans the amino acid sequence from region 20-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 21 TRAV21

UniProt

A0A0B4J279

Expression Region

20-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleolar / Nucleoli (NM95), 0.2mg/mL
BNUB0095-500 1x 500 µL

Nucleolar / Nucleoli (NM95), 0.2mg/mL

Sign In for Pricing
View Details
Timeless Recombinant Rabbit Monoclonal Antibody [JE51-39]
ET7110-23 100 µL

Timeless Recombinant Rabbit Monoclonal Antibody [JE51-39]

Sign In for Pricing
View Details
Polystyrene A RAM
HA110023.100G 100 g

Polystyrene A RAM

Sign In for Pricing
View Details
(2Beta,3Alpha,5Alpha,16Beta,17Beta)-2,16-di-1-Pyrrolidinylandrostane-3,17-diol
TRC-P998580-5MG 5 mg

(2Beta,3Alpha,5Alpha,16Beta,17Beta)-2,16-di-1-Pyrrolidinylandrostane-3,17-diol

Sign In for Pricing
View Details
CGB2 Human Gene Knockout Kit (CRISPR)
KN421679 1 Kit

CGB2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ST13P3 Human qPCR Primer Pair (XM_015334)
HP220729 200 Reactions

ST13P3 Human qPCR Primer Pair (XM_015334)

Sign In for Pricing
View Details