Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 21 (TVA21), Biotinylated

This Recombinant Human T cell receptor alpha variable 21 (TVA21), Biotinylated spans the amino acid sequence from region 20-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 21 TRAV21

UniProt

A0A0B4J279

Expression Region

20-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Breast
CR566333 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
FAM177B (NM_207468) Human Over-expression Lysate
LC404043 20 µg

FAM177B (NM_207468) Human Over-expression Lysate

Sign In for Pricing
View Details
AF9 (MLLT3) Rabbit Polyclonal Antibody
TA368905 100 µL

AF9 (MLLT3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD6 (3F7B5), CF640R conjugate, 0.1mg/mL
BNC400428-500 1x 500 µL

CD6 (3F7B5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Periostin Antibody (HRP)
KH-2690-01 50 μL

Periostin Antibody (HRP)

Sign In for Pricing
View Details
Periostin Antibody (HRP)
KH-2690-02 100 µL

Periostin Antibody (HRP)

Sign In for Pricing
View Details