Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 40 (TVA40), Biotinylated

This Recombinant Human T cell receptor alpha variable 40 (TVA40), Biotinylated spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 40 TRAV40

UniProt

A0A0B4J280

Expression Region

20-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NSVKQTGQITVSEGASVTMNCTYTSTGYPTLFWYVEYPSKPLQLLQRETMENSKNFGGGNIKDKNSPIVKYSVQVSDSAVYYCLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFβ1 (3C11) : m-IgG Fc BP-HRP Bundle
sc-527081 1 Kit

TGFβ1 (3C11) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
CF®568 Goat Anti-Mouse IgG1 (γ1), 2mg/mL
#20248-1 1x 50 µL

CF®568 Goat Anti-Mouse IgG1 (γ1), 2mg/mL

Sign In for Pricing
View Details
Anti-CCR8 (denikitug biosimilar) mAb
MBS1881114-01 0.05 mg

Anti-CCR8 (denikitug biosimilar) mAb

Sign In for Pricing
View Details
Anti-CCR8 (denikitug biosimilar) mAb
MBS1881114-02 0.1 mg

Anti-CCR8 (denikitug biosimilar) mAb

Sign In for Pricing
View Details
Anti-CCR8 (denikitug biosimilar) mAb
MBS1881114-03 5x 0.1 mg

Anti-CCR8 (denikitug biosimilar) mAb

Sign In for Pricing
View Details
Anti-IFNa1 Antibody (Baylor patent anti-IFN alpha)
F2004-.1 100 µg

Anti-IFNa1 Antibody (Baylor patent anti-IFN alpha)

Sign In for Pricing
View Details