Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 40 (TVA40), Biotinylated

This Recombinant Human T cell receptor alpha variable 40 (TVA40), Biotinylated spans the amino acid sequence from region 20-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 40 TRAV40

UniProt

A0A0B4J280

Expression Region

20-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NSVKQTGQITVSEGASVTMNCTYTSTGYPTLFWYVEYPSKPLQLLQRETMENSKNFGGGNIKDKNSPIVKYSVQVSDSAVYYCLLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD37 (LPR2BP, Ankyrin Repeat Domain-containing Protein 37, Low-density Lipoprotein Receptor-related Protein 2-binding Protein, MGC111507) (AP)
MBS6129999-01 0.1 mL

ANKRD37 (LPR2BP, Ankyrin Repeat Domain-containing Protein 37, Low-density Lipoprotein Receptor-related Protein 2-binding Protein, MGC111507) (AP)

Sign In for Pricing
View Details
ANKRD37 (LPR2BP, Ankyrin Repeat Domain-containing Protein 37, Low-density Lipoprotein Receptor-related Protein 2-binding Protein, MGC111507) (AP)
MBS6129999-02 5x 0.1 mL

ANKRD37 (LPR2BP, Ankyrin Repeat Domain-containing Protein 37, Low-density Lipoprotein Receptor-related Protein 2-binding Protein, MGC111507) (AP)

Sign In for Pricing
View Details
Human DuSP19 Recombinant Protein
PROTQ8WTR2-250ug 250 µg

Human DuSP19 Recombinant Protein

Sign In for Pricing
View Details
BMY 7378
B2263-100 100 mg

BMY 7378

Sign In for Pricing
View Details
F11R Knockout Hela Polyclonal Cells
ARG8170 1 Million

F11R Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
C1orf128 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0212305 3x 1.0 µg

C1orf128 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details