Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1D-13 (KVD13), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-13 IGKV1D-13

UniProt

A0A0B4J2D9

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIQLTQSPSSLSASVGDRVTITCRASQGISSALAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQFNSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEX29 (NM_152324) Human Over-expression Lysate
E45H14483-2 20 µg

TEX29 (NM_152324) Human Over-expression Lysate

Sign In for Pricing
View Details
C8orf59 Antibody, HRP conjugated
CSB-PA836635LB01HU-01 50 µg

C8orf59 Antibody, HRP conjugated

Sign In for Pricing
View Details
C8orf59 Antibody, HRP conjugated
CSB-PA836635LB01HU-02 100 µg

C8orf59 Antibody, HRP conjugated

Sign In for Pricing
View Details
Lentiviral human ZIK1 shRNA (UAS) - Lentiviral human ZIK1 shRNA (UAS) plasmid
GTR15102043 1 Vial

Lentiviral human ZIK1 shRNA (UAS) - Lentiviral human ZIK1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Anti-Mouse CD48 Monoclonal Antibody (PE/Cyanine5.5 Conjugated)
DL20335F-01 25 μg

Anti-Mouse CD48 Monoclonal Antibody (PE/Cyanine5.5 Conjugated)

Sign In for Pricing
View Details
Anti-Mouse CD48 Monoclonal Antibody (PE/Cyanine5.5 Conjugated)
DL20335F-02 50 μg

Anti-Mouse CD48 Monoclonal Antibody (PE/Cyanine5.5 Conjugated)

Sign In for Pricing
View Details