Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-4 (TVBL4), Biotinylated

This Recombinant Human T cell receptor beta variable 12-4 (TVBL4), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-4 TRBV12-4

UniProt

A0A0B4J2E0

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIQSPRHEVTEMGQEVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYH4 shRNA (h) Lentiviral Particles
sc-106274-V 200 µL

MYH4 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
HSGT1 (Ecdysoneless Homolog (Drosophila), GCR2, HSGT1) (FITC)
247280-FITC 100 µL

HSGT1 (Ecdysoneless Homolog (Drosophila), GCR2, HSGT1) (FITC)

Sign In for Pricing
View Details
Yamogenin
C11242-01 5 mg

Yamogenin

Sign In for Pricing
View Details
Yamogenin
C11242-02 25 mg

Yamogenin

Sign In for Pricing
View Details
Lentiviral mouse Msto1 shRNA (UAS) - Lentiviral mouse Msto1 shRNA (UAS, iRFP) plasmid
GTR15195304 1 Vial

Lentiviral mouse Msto1 shRNA (UAS) - Lentiviral mouse Msto1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
CD20 Rabbit pAb, APC-Cy5.5 conjugated
orb2838224 100 µL

CD20 Rabbit pAb, APC-Cy5.5 conjugated

Sign In for Pricing
View Details