Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-4 (TVBL4), Biotinylated

This Recombinant Human T cell receptor beta variable 12-4 (TVBL4), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-4 TRBV12-4

UniProt

A0A0B4J2E0

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIQSPRHEVTEMGQEVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRXCR2 (NM_001080516) Human Tagged Lenti ORF Clone
RC213752L3 10 µg

GRXCR2 (NM_001080516) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal PRRX2 Antibody
NBP3-16048-20ul 20 µL

Rabbit Polyclonal PRRX2 Antibody

Sign In for Pricing
View Details
AIF Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-0037R-PE-Cy5.5 100 µL

AIF Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal ROS Antibody (ROS1/8268R) [DyLight 350]
NBP3-20759UV 0.1 mL

Rabbit Monoclonal ROS Antibody (ROS1/8268R) [DyLight 350]

Sign In for Pricing
View Details
Mouse TBC1 domain family member 1, TBC1D1 ELISA KIT
E2504Mo-01 48 Well

Mouse TBC1 domain family member 1, TBC1D1 ELISA KIT

Sign In for Pricing
View Details
Mouse TBC1 domain family member 1, TBC1D1 ELISA KIT
E2504Mo-02 96 Well

Mouse TBC1 domain family member 1, TBC1D1 ELISA KIT

Sign In for Pricing
View Details