Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-69D (HV69D), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-69D IGHV1-69D

UniProt

A0A0B4J2H0

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli DRAA Polyclonal Antibody
MBS7158745 Inquire

Rabbit anti-Escherichia coli DRAA Polyclonal Antibody

Sign In for Pricing
View Details
Guinea pig Calcineurin (CaN) ELISA Kit
NSL1041Gp 96 Tests

Guinea pig Calcineurin (CaN) ELISA Kit

Sign In for Pricing
View Details
Human WDR74 qPCR Primer Pair
QH42869S 200 Tests

Human WDR74 qPCR Primer Pair

Sign In for Pricing
View Details
3-oxo-5-α-steroid 4-Dehydrogenase 2 (SRD5A2) Mouse ELISA Kit
B0621 96 Tests

3-oxo-5-α-steroid 4-Dehydrogenase 2 (SRD5A2) Mouse ELISA Kit

Sign In for Pricing
View Details
SHANK1a C-terminus
RA19016 100 µg

SHANK1a C-terminus

Sign In for Pricing
View Details
D4Bwg0951e AAV Vector (Mouse) (CMV)
17601104 1 µg

D4Bwg0951e AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details