Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-20 (KVD20), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 3D-20 (KVD20), Biotinylated spans the amino acid sequence from region 21-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-20 IGKV3D-20

UniProt

A0A0C4DH25

Expression Region

21-116

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPATLSLSPGERATLSCGASQSVSSSYLAWYQQKPGLAPRLLIYDASSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PC-1 (F-8) : m-IgG1 BP-HRP Bundle
sc-545209 1 Kit

PC-1 (F-8) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Presenilin 2 antibody
70R-13901 0.1 mg

Presenilin 2 antibody

Sign In for Pricing
View Details
POLL Rabbit Polyclonal Antibody (HRP)
orb2105861 100 µL

POLL Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Tupaiid herpesvirus DNA polymerase (DPOL), partial
MBS1279296 Inquire

Recombinant Tupaiid herpesvirus DNA polymerase (DPOL), partial

Sign In for Pricing
View Details
Mithramycin A
50053396 5 mg

Mithramycin A

Sign In for Pricing
View Details
Pex3 ORF Vector (Mouse) (pORF)
36415014 1.0 µg DNA

Pex3 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details