Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 6D-41 (KVD41), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin kappa variable 6D-41 (KVD41), Biotinylated spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 6D-41 IGKV6D-41

UniProt

A0A0C4DH26

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DVVMTQSPAFLSVTPGEKVTITCQASEGIGNYLYWYQQKPDQAPKLLIKYASQSISGVPSRFSGSGSGTDFTFTISSLEAEDAATYYCQQGNKHP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAVIN1 (NM_012232) Human Recombinant Protein
TP309277M 100 µg

CAVIN1 (NM_012232) Human Recombinant Protein

Sign In for Pricing
View Details
Electric lift patient transfer Wheelchair BHBD-1102
BHBD-1102 1 Unit

Electric lift patient transfer Wheelchair BHBD-1102

Sign In for Pricing
View Details
N-Acetyl Axitinib
TRC-A134560-25MG 25 mg

N-Acetyl Axitinib

Sign In for Pricing
View Details
C6 Ceramide
TRC-C262600-50MG 50 mg

C6 Ceramide

Sign In for Pricing
View Details
Mouse Cbl activation kit by CRISPRa
GA200561 1 Kit

Mouse Cbl activation kit by CRISPRa

Sign In for Pricing
View Details
TRPM2 Human Gene Knockout Kit (CRISPR)
KN416220 1 Kit

TRPM2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details